PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g51540.1.p
Common NameBRADI_3g51540, LOC100841844
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family HD-ZIP
Protein Properties Length: 792aa    MW: 85339.6 Da    PI: 5.3763
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g51540.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.63.3e-2188143156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++ +++t++q++eLe+lF+++++p++++r+eL+++l+L+ rqVk+WFqNrR+++k
  Bradi3g51540.1.p  88 KKRYHRHTPQQIQELEALFKECPHPDEKQRAELSRRLSLDARQVKFWFQNRRTQMK 143
                       678899***********************************************999 PP

2START177.96.1e-563025331206
                       HHHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS...........SCEEEEEEEECCSCH.HHHHHHHHCCCGGCT-TT-S....E CS
             START   1 elaeeaaqelvkkalaeepgWvkssesengdevlqkfeeskv..........dsgealrasgvvdmv.lallveellddkeqWdetla....k 78 
                       ela +a++el+k+a++++p+Wv+   +++++e+l  +e   +          + +ea+r+sg+v+ + ++ lve+l+d + +W+ ++     k
  Bradi3g51540.1.p 302 ELAISAMDELIKMAQVDDPLWVTGLPGSPNKETLNFEEYHSFlpgigmkpagFVSEASRESGLVIIDnSVALVETLMDER-RWSDMFScmiaK 393
                       57889********************7777777776665554477777***************998651669*********.************ PP

                       EEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--......-TTSEE-EESSEEEEEEEECT CS
             START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.....sssvvRaellpSgiliepksn 159
                       a++le +s+g      g l lm+aelq+lsplvp R++ f+R+++ql +g w++vdvS+d     ++     ++   ++++lpSg+++++++ 
  Bradi3g51540.1.p 394 ATILEEVSTGiagsrnGSLLLMKAELQVLSPLVPiREVIFLRFCKQLAEGAWAVVDVSIDGLMRDQNsattsTAANLKCRRLPSGCVMQDTPS 486
                       ***********************************************************853222222245689999**************** PP

                       CEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 160 ghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                       g +kvtwveh++++++++h+ +r+l++sgla+ga++w+atlqrqce+
  Bradi3g51540.1.p 487 GFCKVTWVEHTEYDEASVHQFYRPLLRSGLAFGASRWLATLQRQCEC 533
                       *********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.67E-2171145IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.4E-2375145IPR009057Homeodomain-like
PROSITE profilePS5007118.12385145IPR001356Homeobox domain
SMARTSM003891.5E-1986149IPR001356Homeobox domain
CDDcd000865.20E-1987145No hitNo description
PfamPF000469.3E-1988143IPR001356Homeobox domain
PROSITE patternPS000270120143IPR017970Homeobox, conserved site
SuperFamilySSF559611.1E-28293533No hitNo description
PROSITE profilePS5084845.872293536IPR002913START domain
CDDcd088752.37E-109297532No hitNo description
SMARTSM002343.1E-39302533IPR002913START domain
PfamPF018521.2E-48303533IPR002913START domain
SuperFamilySSF559617.56E-22554758No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048497Biological Processmaintenance of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 792 aa     Download sequence    Send to blast
MSFGGLFDGG GGGGMQFPYP GGFSSSPALS LALDNAGGIG GRMFADGAMA GDAEAQNDSR  60
SGSDHLDAIS GVGDDDDDAE PSNPRKRKKR YHRHTPQQIQ ELEALFKECP HPDEKQRAEL  120
SRRLSLDARQ VKFWFQNRRT QMKTQLERHE NALLKQENDK LRAENMTIRE AMRSPMCGGC  180
GSPAMLGEVS LEEQHLRIEN ARLKDELNRV CALATKFLGK PVSLMSPLQL QPHLSMHLPN  240
SSLELAVGGM GGIGSMQPTL HGTMSEFAGG ASSSMGTVIT PARATGSAIA SITDIDRSMF  300
LELAISAMDE LIKMAQVDDP LWVTGLPGSP NKETLNFEEY HSFLPGIGMK PAGFVSEASR  360
ESGLVIIDNS VALVETLMDE RRWSDMFSCM IAKATILEEV STGIAGSRNG SLLLMKAELQ  420
VLSPLVPIRE VIFLRFCKQL AEGAWAVVDV SIDGLMRDQN SATTSTAANL KCRRLPSGCV  480
MQDTPSGFCK VTWVEHTEYD EASVHQFYRP LLRSGLAFGA SRWLATLQRQ CECLAILMSP  540
PTVAASEPMA ISLEGKRSML KLARRMTDNF CAGVSASSAR EWSKLDGATG SIGEDVRVMA  600
RKSVSEPGEP PGVVLSAATS VWVPVAPEKL FDFLRDEQLR AEWDILSNGG PMQEMTRIAK  660
GHQNGNSVSL LRASAMSANQ SSMLILQETC TDASGSIVVY APVDIPAMQL VMEGRDSTCV  720
ALLPSGFAIL PDGPSIEQKT GGSLLTVAFQ ILVNSQPTAK LTVESVETVN NLISCTIKKI  780
KTALLCTTPD C*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18389PRKRKKR
28488RKRKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00418DAPTransfer from AT3G61150Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF8574840.0KF857484.1 Avena strigosa cultivar S75 homeobox-leucine zipper protein (HDZ1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003570085.10.0PREDICTED: homeobox-leucine zipper protein ROC5
SwissprotQ6EPF00.0ROC5_ORYSJ; Homeobox-leucine zipper protein ROC5
TrEMBLI1ICJ50.0I1ICJ5_BRADI; Uncharacterized protein
STRINGBRADI3G51540.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP120337116
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.10.0homeodomain GLABROUS 1